HORDB

ID: hor005500
Uniprot ID: P83485
Protein name: Crustacean hyperglycemic hormone A
Gene name: NA
Organism: Cherax destructor (Common yabby crayfish)
Family: arthropod CHH/MIH/GIH/VIH hormone family
Source: animal
Expression: medulla terminalis X-organ in the eyestalks
Disease: NA
Comments: NA
Taxonomy: Cherax (genus), Parastacidae (family), Parastacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
GO BP: GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV
Length: 72
Propeptide: QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV
Signal peptide: NA
Modification: T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
Glycosylation: NA
Mutagenesis: NA

Function: Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P83485-F1.pdb

hor005500_AF2.pdb

hor005500_ESM.pdb

Mass:	964119	Formula:	C372H567N101O108S6
Absent amino acids:	HMW	Common amino acids:	V
pI:	7.72	Basic residues:	9
Polar residues:	26	Hydrophobic residues:	24
Hydrophobicity:	-20.83	Boman Index:	-12865
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	79.72
Instability Index:	1894.44	Extinction Coefficient cystines:	9315
Absorbance 280nm:	131.2

PubMed ID: 15127939
Title: Two genetic variants of the crustacean hyperglycemic hormone (CHH) from the Australian crayfish, Cherax destructor: detection of chiral isoforms due to posttranslational modification.