General Information

  • ID:  hor005500
  • Uniprot ID:  P83485
  • Protein name:  Crustacean hyperglycemic hormone A
  • Gene name:  NA
  • Organism:  Cherax destructor (Common yabby crayfish)
  • Family:  arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  medulla terminalis X-organ in the eyestalks
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cherax (genus), Parastacidae (family), Parastacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV
  • Length:  72
  • Propeptide:  QVFDQACKGVYDRAIFKKLDRVCDDCYNLYRKPYVAVSCRGNCYNNLVFRQCLEELFLGNGFNEYISGVQTV
  • Signal peptide:  NA
  • Modification:  T1 Pyrrolidone carboxylic acid;T3 D-phenylalanine;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Control the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P83485-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P83485-F1.pdbhor005500_AF2.pdbhor005500_ESM.pdb

Physical Information

Mass: 964119 Formula: C372H567N101O108S6
Absent amino acids: HMW Common amino acids: V
pI: 7.72 Basic residues: 9
Polar residues: 26 Hydrophobic residues: 24
Hydrophobicity: -20.83 Boman Index: -12865
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 79.72
Instability Index: 1894.44 Extinction Coefficient cystines: 9315
Absorbance 280nm: 131.2

Literature

  • PubMed ID:  15127939
  • Title:  Two genetic variants of the crustacean hyperglycemic hormone (CHH) from the Australian crayfish, Cherax destructor: detection of chiral isoforms due to posttranslational modification.